PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g089990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 739aa    MW: 83289.2 Da    PI: 8.5005
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g089990.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.31.5e-14691196
                    EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                    ffk l     + s+ l++p  f+ ++  g   +e+kt  l++  s   W+vk+  ++++    lt+GWkeF+ a+ L+ gD++vFk +++++f  +v
  Csa09g089990.1  6 FFKPL--LPGFHSH-LTIPVAFFLKNvqGR--NEQKTAELRSdASKIIWKVKI--DGQR----LTNGWKEFALAHALRIGDILVFKQERDMSF--HV 89
                    66666..5667777.***********7443..4567888888588899*****..9888....***********************8777888..66 PP

                    EE CS
              B3 95 kv 96
                     +
  Csa09g089990.1 90 II 91
                    55 PP

2B364.12.1e-201362071790
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     +lp +f++++g++ +++ +++l++e+grsW+v l+ r ++ +y+ ++GW++F++angL++gDf  Fkl++r ++
  Csa09g089990.1 136 TLPMSFVRANGLDRRCG-EIILMNEKGRSWSVSLKRRSCGTTYIRGGGWRSFCQANGLRAGDFSSFKLIQR-GG 207
                     79***********9887.****************544444459999**********************996.33 PP

3B357.82e-18263357799
                     .-HHHHTT-E....E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   7 psdvlksgrl....vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +s++l++ rl    +lp +f++ +g++k++  ++++ d++g +W+ k++++  ++r+ l++GWkeF++ang+k g++++++l++  +++ v+k++
  Csa09g089990.1 263 NSSSLSHPRLnlsqTLPIPFTKVNGLQKAK--KMSFLDKHGVKWSTKMCFEVERNRMGLAGGWKEFCNANGVKIGESIILELVWGADRSSVLKFC 355
                     5666666555555599***********765..8**************************************************998888999999 PP

                     -S CS
              B3  98 rk 99 
                     +k
  Csa09g089990.1 356 SK 357
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-183101IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-203107IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.702395IPR003340B3 DNA binding domain
CDDcd100171.77E-13592No hitNo description
SMARTSM010193.5E-22695IPR003340B3 DNA binding domain
PfamPF023621.4E-91489IPR003340B3 DNA binding domain
PROSITE profilePS5086315.298120217IPR003340B3 DNA binding domain
SMARTSM010195.0E-20123217IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-16135206IPR015300DNA-binding pseudobarrel domain
PfamPF023622.5E-18136208IPR003340B3 DNA binding domain
CDDcd100171.37E-19136213No hitNo description
SuperFamilySSF1019362.16E-15136209IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-19239357IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-17243361IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.7E-17247358IPR003340B3 DNA binding domain
CDDcd100178.61E-16262355No hitNo description
PfamPF023622.0E-17264357IPR003340B3 DNA binding domain
PROSITE profilePS5086311.871278357IPR003340B3 DNA binding domain
Gene3DG3DSA:1.20.1280.508.7E-6369409No hitNo description
SuperFamilySSF813836.67E-7371422IPR001810F-box domain
PfamPF006461.8E-5373410IPR001810F-box domain
SMARTSM002569.7E-4377418IPR001810F-box domain
PfamPF034782.7E-7654693IPR005174Domain unknown function DUF295
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MANQHFFKPL LPGFHSHLTI PVAFFLKNVQ GRNEQKTAEL RSDASKIIWK VKIDGQRLTN  60
GWKEFALAHA LRIGDILVFK QERDMSFHVI ILGPSCCPIQ YVSSLNNQNN LGQLCSFASL  120
TDILKKCAHI VEYESTLPMS FVRANGLDRR CGEIILMNEK GRSWSVSLKR RSCGTTYIRG  180
GGWRSFCQAN GLRAGDFSSF KLIQRGGTLG LRISPGEIEE EDCLSEGNVV KSRSIWKASS  240
SESQNRFVTV TLTPYNIRES KLNSSSLSHP RLNLSQTLPI PFTKVNGLQK AKKMSFLDKH  300
GVKWSTKMCF EVERNRMGLA GGWKEFCNAN GVKIGESIIL ELVWGADRSS VLKFCSKVSK  360
LQLSPATKEQ TPEWSLLPGE LLQLILTYLD NCFEVVHVRS VCTTWRSAIP FPSCLLRLSY  420
SLPTFADFPY DSRDLCILEK IPLFLFRVRD TSPCEYFLGD IGLVDESENH YHMEPLQCTV  480
KVKIPGSEKP TLMNMLDCQI IPLGHQYRMI GWDPEAWTSA YRGVALLPLN KQGGGFVVLL  540
NYTKVLLVLT SGEMRWMRVK KFSDASCWDL FIFRGRFYAV FLNGEIFVID PCSLEATPLK  600
PSQLLNSSNY LVPSGDDELF LVEKIVPRYG ELDYFRLVCR VSRLDEEAGE WVVVSDLGDR  660
VLFIGELGNF SFSAKELPPG GCGVSGNSVL FTNGPGNVTY AYRYDVETGN LSFWRFSREN  720
RVMILNRSPP VLALQVER*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429470.10.0PREDICTED: F-box/kelch-repeat protein At1g64840-like
SwissprotQ9XIR11e-141FBK27_ARATH; F-box/kelch-repeat protein At1g64840
TrEMBLR0FW580.0R0FW58_9BRAS; Uncharacterized protein
STRINGscaffold_400833.11e-163(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-90B3 family protein